PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00166.1_g00023.1
Common NameRsLFY1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family LFY
Protein Properties Length: 415aa    MW: 46239.9 Da    PI: 7.021
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00166.1_g00023.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY616.54.9e-18813911386
                  FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaa..vseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkde 84 
                              mdpe f++ lf+w+p  a+++++++  +     ++++p++ ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkde
  Rsa1.0_00166.1_g00023.1   1 MDPEGFTSGLFRWNPTRAMVQQQQQQPPPVPppQQQPPATPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDE 86 
                              9*************7666544333222222200233334455666666677*********************************** PP

                  FLO_LFY  85 elddlmkslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll.....sedeetaldalsqeglseepvqeeke.aag 162
                              el+d+m+sls+ifr++llvGeryG+kaavraerrrl+e  ee+ ++rr+ll      + +++aldalsqeglse+pv++ ++ +a+
  Rsa1.0_00166.1_g00023.1  87 ELEDMMNSLSHIFRWELLVGERYGVKAAVRAERRRLQEeeEEEYSRRRHLLlsaagDSGTHHALDALSQEGLSEDPVHQLEHtDAA 172
                              ************************************99443445677777768744344556***************995551444 PP

                  FLO_LFY 163 sggeglgeaelvaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeegsgedge...erqrehPfivtepgevargk 245
                               +++  g +e+ +++       kk +  +++++k+  ++++++d+ +e e+d+d++g+g +g    erqrehPfivtepgevargk
  Rsa1.0_00166.1_g00023.1 173 GNNAVGGYWEAGQTK------MKKPQ--QRRRKKQVVTSVETDDDMNEGEDDDDGNGNGGGGVlgiERQREHPFIVTEPGEVARGK 250
                              444444555544333......22222..23333444333333333333344444444333333445******************** PP

                  FLO_LFY 246 knGLDYLfdLyeqCrefLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkerge 331
                              knGLDYLf+LyeqCrefL+qvq+iak+rGekcPtkvtnqvfryakk+gasyinkPkmrhYvhCYalhcLdeeasnalrrafkerge
  Rsa1.0_00166.1_g00023.1 251 KNGLDYLFHLYEQCREFLVQVQTIAKDRGEKCPTKVTNQVFRYAKKSGASYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGE 336
                              ************************************************************************************** PP

                  FLO_LFY 332 nvGawrqacykplvaiaarqgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                              nvG+wrqacykplv+ia r+gwdidavfnahprLsiWYvPtkLrqLChler++a+
  Rsa1.0_00166.1_g00023.1 337 NVGSWRQACYKPLVDIACRHGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 391
                              ***************************************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016985.8E-1971390IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 415 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRAMV QQQQQQPPPV PPPQQQPPAT PQTAAFGMRL GGLEGLFGPY  60
GVRFYTAAKI AELGFTASTL VGMKDEELED MMNSLSHIFR WELLVGERYG VKAAVRAERR  120
RLQEEEEEEY SRRRHLLLSA AGDSGTHHAL DALSQEGLSE DPVHQLEHTD AAGNNAVGGY  180
WEAGQTKMKK PQQRRRKKQV VTSVETDDDM NEGEDDDDGN GNGGGGVLGI ERQREHPFIV  240
TEPGEVARGK KNGLDYLFHL YEQCREFLVQ VQTIAKDRGE KCPTKVTNQV FRYAKKSGAS  300
YINKPKMRHY VHCYALHCLD EEASNALRRA FKERGENVGS WRQACYKPLV DIACRHGWDI  360
DAVFNAHPRL SIWYVPTKLR QLCHLERNNA VAAASALVGN GISCTGSSAS GGFGV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1262284111183PROTEIN LEAFY
2vy2_A1e-1262284111183PROTEIN LEAFY
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1190198PQQRRRKKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4492480.0AB449248.1 Raphanus sativus RsLFY1 mRNA for leafy-like protein, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013727957.10.0PREDICTED: protein LEAFY
RefseqXP_013675387.10.0PREDICTED: protein LEAFY
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLB7XD690.0B7XD69_RAPSA; Leafy-like protein
STRINGBra029305.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)